PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2983s0116.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HB-other
Protein Properties Length: 512aa    MW: 57257.4 Da    PI: 9.3555
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2983s0116.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.12.9e-182176257
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                         +kR+  t+ q+ +Le+++++++yp++e++ +LA+++gLte+qV+ WF+ rR k+k+
  Bostr.2983s0116.1.p 21 KKRRLKTPIQVMALENFYNEHKYPTEEMKGKLAEEIGLTEKQVSGWFCHRRLKDKR 76
                         8999**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-20476IPR009057Homeodomain-like
SuperFamilySSF466895.13E-171579IPR009057Homeodomain-like
PROSITE profilePS5007116.6651777IPR001356Homeobox domain
SMARTSM003896.1E-191981IPR001356Homeobox domain
CDDcd000865.26E-172177No hitNo description
PfamPF000461.2E-152176IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MHSDSGEAPP DGDKASTENS KKRRLKTPIQ VMALENFYNE HKYPTEEMKG KLAEEIGLTE  60
KQVSGWFCHR RLKDKRSVKE DGNTIGSQDR SSVVLQDRGS GLRQDSCGST KQTDYWNPKP  120
REVESQRLYG GPYMGNADGE DSTSSERSSS LHKNLVSSKD GIRDVESSRY VTHNDVIQHP  180
QVMRSYGYNK PSGYLKVKRE SENVAITAVK RQLGRQYQED GPPLGVEFDP LPPGAFEPQT  240
NAIVQEPIYV GNQRRSHPPH LLGTRKSFNP GPSYELTRKL KMHLPDPDPD SEEEDDDNDN  300
IMVGMEPGLR DKKSLGEPRL KSPSPSFYNS VPNHKSFKET FKGSPREIPV SNSKKGRISS  360
KGWAEGSRNN LIANFHNIPG SNIETNQTHN YDKKIFNGGR KTGYLTKSSK LLPPSRSRSP  420
DSIDRGPSSV MAGKYHGERN QTKTHREKLH STDEPPVTKR VKHGYLQQVY APKSSYSEIL  480
ERKGQINRSG VELPSSLSGD DETDESSSSM D*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12025KKRRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412960.0AJ441296.1 Arabidopsis thaliana mRNA for homeodomain protein 14 (hd-14 gene).
GenBankBT0263720.0BT026372.1 Arabidopsis thaliana At4g03250 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010422483.10.0PREDICTED: uncharacterized protein LOC104707761
TrEMBLR0HBG10.0R0HBG1_9BRAS; Uncharacterized protein
STRINGAT4G03250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122022531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.10.0HB-other family protein